PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_129.74
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 210aa    MW: 23756.8 Da    PI: 10.994
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_129.74genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.29.5e-1087144562
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                   ++ rr+ +NRe+ArrsR RK++ +e+L++    L  eN++  ++l     +++++++e
  evm.model.supercontig_129.74  87 RKLRRMVSNRESARRSRMRKQKHLENLRNQLNRLRMENREFSNRLRFVAYHCQRVRNE 144
                                   5789**************************************9999999999988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-1083147IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.385148IPR004827Basic-leucine zipper domain
PfamPF001703.3E-787145IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.3E-787160No hitNo description
SuperFamilySSF579591.77E-987135No hitNo description
CDDcd147027.94E-1888139No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MLSAVMPPVS SFDPALDNPF SAFESGFTPW DFSGSDLFSP MHSPSPKPVE SNSGSDDPTP  60
KHTATKLKSS SDGTAGSTKT VSVVDERKLR RMVSNRESAR RSRMRKQKHL ENLRNQLNRL  120
RMENREFSNR LRFVAYHCQR VRNENDRLRS EHTLLRQKLS EIRQILLLRQ VQQLSSFAWP  180
CNSTAASTVT SINEQFTAPL ISNHVILNT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199106RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426133.16e-71hypothetical protein CICLE_v10027584mg
TrEMBLV4RWX27e-71V4RWX2_9R
STRINGVIT_00s0541g00020.t016e-56(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Representative plantOGRP8744815
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.14e-26basic leucine-zipper 5